(data stored in ACNUC7421 zone)

EMBL: CP001389.PE599

CP001389.PE599       Location/Qualifiers
FT   CDS             665217..665801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06100"
FT                   /product="adenylate kinase"
FT                   /note="ATP-AMP transphosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24403"
FT                   /db_xref="GOA:C3MI55"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI55"
FT                   /protein_id="ACP24403.1"
FT                   /translation="MVNLVLLGPPGAGKGTQAERLVRDYDLLHISTGDLLRDAIKAQSP
FT                   LGRKAKMAVDEGKLVPDEVVVGLVEERLTDKEPGQGFILDGFPRTIAQAGALERLLESM
FT                   QVPLDHVILFDIPIRLLEERIAKRAEQTRSAGAQPRTDDSPEVLKKRIEEFARATAALS
FT                   PFYEQNGLLRRVDASEDIERVATQIRDFLQP"
     MVNLVLLGPP GAGKGTQAER LVRDYDLLHI STGDLLRDAI KAQSPLGRKA KMAVDEGKLV        60
     PDEVVVGLVE ERLTDKEPGQ GFILDGFPRT IAQAGALERL LESMQVPLDH VILFDIPIRL       120
     LEERIAKRAE QTRSAGAQPR TDDSPEVLKK RIEEFARATA ALSPFYEQNG LLRRVDASED       180
     IERVATQIRD FLQP                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page