(data stored in ACNUC7421 zone)

EMBL: CP001389.PE6

CP001389.PE6         Location/Qualifiers
FT   CDS             5020..5634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00060"
FT                   /product="glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23810"
FT                   /db_xref="GOA:C3MEI7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI7"
FT                   /protein_id="ACP23810.1"
FT                   /translation="MILYYQTHSPFARKALVFAHEIGLADRLEVVHHETSPTRRNDDVY
FT                   AENPLGKVPVLLRSDAEPIFDSDVICAYFDTLHERRKLIPESGEPRWRALRLQSVAQVL
FT                   AQTGIGLRWEWERRPEQLRWPALAKGYEEKIEATYDWLDTTFLPEEDIDVGQIALATTL
FT                   SWMAFRALPSFRDRSRLTRWFDAFEQRASMVATPLSGETQD"
     MILYYQTHSP FARKALVFAH EIGLADRLEV VHHETSPTRR NDDVYAENPL GKVPVLLRSD        60
     AEPIFDSDVI CAYFDTLHER RKLIPESGEP RWRALRLQSV AQVLAQTGIG LRWEWERRPE       120
     QLRWPALAKG YEEKIEATYD WLDTTFLPEE DIDVGQIALA TTLSWMAFRA LPSFRDRSRL       180
     TRWFDAFEQR ASMVATPLSG ETQD                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page