(data stored in ACNUC7421 zone)

EMBL: CP001389.PE60

CP001389.PE60        Location/Qualifiers
FT   CDS             complement(63273..63869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00600"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23864"
FT                   /db_xref="GOA:C3MF27"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF27"
FT                   /protein_id="ACP23864.1"
FT                   /translation="MPLLDEVLAYIKGLWLLIQGNRDGYNWLDISEGGLWRSFAAILWS
FT                   LPAMAVSWASWRLYYLSAMPSGTTVGIGFFLKLLVVDLVSWLLPIVLVAALSRPLGFGP
FT                   LVVPVIVTTNWLSVPLSYAMAIPAALLLLARGGHQLTALLSLIVLVAGVVLLFRLLRTI
FT                   TGNQNLLASALTALYLLPSMMLAQYLQHFFGLIPG"
     MPLLDEVLAY IKGLWLLIQG NRDGYNWLDI SEGGLWRSFA AILWSLPAMA VSWASWRLYY        60
     LSAMPSGTTV GIGFFLKLLV VDLVSWLLPI VLVAALSRPL GFGPLVVPVI VTTNWLSVPL       120
     SYAMAIPAAL LLLARGGHQL TALLSLIVLV AGVVLLFRLL RTITGNQNLL ASALTALYLL       180
     PSMMLAQYLQ HFFGLIPG                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page