(data stored in ACNUC7421 zone)

EMBL: CP001389.PE600

CP001389.PE600       Location/Qualifiers
FT   CDS             complement(665877..666518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06110"
FT                   /product="putative L-fuculose-phosphate aldolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24404"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI56"
FT                   /protein_id="ACP24404.1"
FT                   /translation="MAALSEETRTRDNIVRAGKSIFDRGLTFGSTGNISVKMSDGRMLM
FT                   TPTNASLGSLVPEQLSLFSAEGVHLGGDKPTKEAFLHRCMYCARQHGKAVVHLHSTYSV
FT                   AVSILKDVDEKDVLPPLTAYYVMRVGTLPLVPYFRPGDEKLATAVQEAAATSNAVLMAN
FT                   HGPVVAGRSLEEAQYATEELEETAKLFLMLHGRELRPLSPTQREELTKSI"
     MAALSEETRT RDNIVRAGKS IFDRGLTFGS TGNISVKMSD GRMLMTPTNA SLGSLVPEQL        60
     SLFSAEGVHL GGDKPTKEAF LHRCMYCARQ HGKAVVHLHS TYSVAVSILK DVDEKDVLPP       120
     LTAYYVMRVG TLPLVPYFRP GDEKLATAVQ EAAATSNAVL MANHGPVVAG RSLEEAQYAT       180
     EELEETAKLF LMLHGRELRP LSPTQREELT KSI                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page