(data stored in ACNUC7421 zone)

EMBL: CP001389.PE604

CP001389.PE604       Location/Qualifiers
FT   CDS             complement(669999..670325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24408"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI60"
FT                   /protein_id="ACP24408.1"
FT                   /translation="MTRPQTDGYVVVVEFLVRGDLLNQFREAMMENAATSLRDEPGCSV
FT                   FDVCQDSEQPERIHLYEVYGSRADFDFHLKSAHFLSFNEASQPWVLEKKVQTFERIAAP
FT                   SGGH"
     MTRPQTDGYV VVVEFLVRGD LLNQFREAMM ENAATSLRDE PGCSVFDVCQ DSEQPERIHL        60
     YEVYGSRADF DFHLKSAHFL SFNEASQPWV LEKKVQTFER IAAPSGGH                    108
//

If you have problems or comments...

PBIL Back to PBIL home page