(data stored in ACNUC7421 zone)

EMBL: CP001389.PE609

CP001389.PE609       Location/Qualifiers
FT   CDS             complement(674041..675639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06200"
FT                   /product="putative ribose ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24413"
FT                   /db_xref="GOA:C3MI65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI65"
FT                   /protein_id="ACP24413.1"
FT                   /translation="MTQPMQTPITDPRDVAAVKMTDIKKSYGGVHALKGVSLTIRPGTI
FT                   HALIGENGAGKSTLLKILQGVVIPTEGSIEVFGEHLTAVSPENSRRLGIGMIFQDLSLI
FT                   PTLTIAQNIFLNREPRRMSLLVDERREIEDAAKIIGELNLNVDPRTRVLELSPGQAQLT
FT                   EIAKAISQKARVLILDEPTSALSAQEVDILFKMLRKLTADGTAIIYVSHRMTEIMTIAD
FT                   EITILRDGQNVTSGNIADFTLDTIVQNMVGKRVTGFEYKPHEIDRGTQPALKVRSLSGK
FT                   HGKPSDVSFDLYRGEVLGIAGLMGAGRTELARVLFGVDAKADGTVELDGKVLEFRSPAE
FT                   AIEAGIVLVPESRHDQGLVIEHTVGHNLSLPQLAQLASGPFLDRRREHDLSSELISRLR
FT                   IKTPDADNKVRNLSGGNQQKIVIAKWLATDPSVVILDEPTAGVDIGSKAEIVELIRSIA
FT                   SGGKSVIVISSEPAELLATSDRILVLSNGRLAREISRSEIDAWATTEGDESQSSMIRVE
FT                   LGLQVAIQKASQNVQ"
     MTQPMQTPIT DPRDVAAVKM TDIKKSYGGV HALKGVSLTI RPGTIHALIG ENGAGKSTLL        60
     KILQGVVIPT EGSIEVFGEH LTAVSPENSR RLGIGMIFQD LSLIPTLTIA QNIFLNREPR       120
     RMSLLVDERR EIEDAAKIIG ELNLNVDPRT RVLELSPGQA QLTEIAKAIS QKARVLILDE       180
     PTSALSAQEV DILFKMLRKL TADGTAIIYV SHRMTEIMTI ADEITILRDG QNVTSGNIAD       240
     FTLDTIVQNM VGKRVTGFEY KPHEIDRGTQ PALKVRSLSG KHGKPSDVSF DLYRGEVLGI       300
     AGLMGAGRTE LARVLFGVDA KADGTVELDG KVLEFRSPAE AIEAGIVLVP ESRHDQGLVI       360
     EHTVGHNLSL PQLAQLASGP FLDRRREHDL SSELISRLRI KTPDADNKVR NLSGGNQQKI       420
     VIAKWLATDP SVVILDEPTA GVDIGSKAEI VELIRSIASG GKSVIVISSE PAELLATSDR       480
     ILVLSNGRLA REISRSEIDA WATTEGDESQ SSMIRVELGL QVAIQKASQN VQ               532
//

If you have problems or comments...

PBIL Back to PBIL home page