(data stored in ACNUC7421 zone)

EMBL: CP001389.PE610

CP001389.PE610       Location/Qualifiers
FT   CDS             complement(675689..676819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06210"
FT                   /product="ABC transporter sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24414"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI66"
FT                   /protein_id="ACP24414.1"
FT                   /translation="MSIEISTSIRSLMMVAAVALSAPLAPNAYAIDVTQQIKEIENSPA
FT                   DGPNGEKAVLASDLKLTPEEIEQIKTKNATAAIVMHYTASDWAKAQMAGQKKALDELGI
FT                   KIIATTDAGYKAEQQVADIESVMALKPDIIISVPAEQSATAAAYKKAAAAGIKIVFLDQ
FT                   AAAGMKPGTDYVSLVSSDNRGMGKVAALLMAKALNGKGEIALIPHASDLFATKERVVGF
FT                   KEAIAAFPDIKVVDESGVGGPDFAGESERIASAMLTGHPTLNGLWAVWDVPTEGVLAAA
FT                   RAAGASTDLVITTCDLGVNISLDMAKNGYVKGTGSQRPFGAGYAEGILAGYALLGKEAP
FT                   PYVVLPALAVTRDNLIDAWPQSNGDQAPDILVKAMN"
     MSIEISTSIR SLMMVAAVAL SAPLAPNAYA IDVTQQIKEI ENSPADGPNG EKAVLASDLK        60
     LTPEEIEQIK TKNATAAIVM HYTASDWAKA QMAGQKKALD ELGIKIIATT DAGYKAEQQV       120
     ADIESVMALK PDIIISVPAE QSATAAAYKK AAAAGIKIVF LDQAAAGMKP GTDYVSLVSS       180
     DNRGMGKVAA LLMAKALNGK GEIALIPHAS DLFATKERVV GFKEAIAAFP DIKVVDESGV       240
     GGPDFAGESE RIASAMLTGH PTLNGLWAVW DVPTEGVLAA ARAAGASTDL VITTCDLGVN       300
     ISLDMAKNGY VKGTGSQRPF GAGYAEGILA GYALLGKEAP PYVVLPALAV TRDNLIDAWP       360
     QSNGDQAPDI LVKAMN                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page