(data stored in ACNUC7421 zone)

EMBL: CP001389.PE616

CP001389.PE616       Location/Qualifiers
FT   CDS             681423..682526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06270"
FT                   /product="putative ribose ABC transporter, ribose-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24420"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI72"
FT                   /protein_id="ACP24420.1"
FT                   /translation="MSCTTREDLVTTFKRRTLLCAAVAFAASVGFQPAFAAEPDYNAVF
FT                   PGILMDKDIKPTGQEMKPVKKDNRPLKLGFLPTAMDTYYQRVLAGVKEEIDKRGGAEAI
FT                   ELLVQAPSSQSATDDQIRAMEAWINDGIDAIAVALYNEGALLPSIRRATEAGIPVFLFN
FT                   SPFADNPYYVSDVGYDQSDGGRAQAQWIVDTYGDKEVKIGILEGLPGPHTSQRMKGFNE
FT                   IISKHPNFKIVAQQPAGWVRAQGLSVTENMFTANPDIEVLVALYDEMALGGLQALKAKG
FT                   LNGKVAIVGYENMKEANAAILTGDFSATVDTGAKEEGRNIVRAVDEFLMKGNPLPKKIF
FT                   VSPKVYDATNIKTFDQTDYDYVPQQKM"
     MSCTTREDLV TTFKRRTLLC AAVAFAASVG FQPAFAAEPD YNAVFPGILM DKDIKPTGQE        60
     MKPVKKDNRP LKLGFLPTAM DTYYQRVLAG VKEEIDKRGG AEAIELLVQA PSSQSATDDQ       120
     IRAMEAWIND GIDAIAVALY NEGALLPSIR RATEAGIPVF LFNSPFADNP YYVSDVGYDQ       180
     SDGGRAQAQW IVDTYGDKEV KIGILEGLPG PHTSQRMKGF NEIISKHPNF KIVAQQPAGW       240
     VRAQGLSVTE NMFTANPDIE VLVALYDEMA LGGLQALKAK GLNGKVAIVG YENMKEANAA       300
     ILTGDFSATV DTGAKEEGRN IVRAVDEFLM KGNPLPKKIF VSPKVYDATN IKTFDQTDYD       360
     YVPQQKM                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page