(data stored in ACNUC7421 zone)

EMBL: CP001389.PE617

CP001389.PE617       Location/Qualifiers
FT   CDS             682575..684110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06280"
FT                   /product="putative ribose ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24421"
FT                   /db_xref="GOA:C3MI73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI73"
FT                   /protein_id="ACP24421.1"
FT                   /translation="MANNPLLEMKGIGKRFGNMVALQGIDLALSGGEVLGLVGENGAGK
FT                   STLMKILAGAYSRDGGTIAVRGKEVELDSPKAGADAGIAIIYQELSLFPDFNAAENIFA
FT                   GRELRRSGFSLAPLSHGQMRREARRLLSEELGVEVAIDRPVRELSLSDRQMIEIAKALN
FT                   SNADIIIMDEPTEALEEVERKQLFAIINRLQAAGKAIIYVSHRIKELLGICSRVMVLRD
FT                   GRTAADLPVADLDVDKVVAAMIGGALSKQFPPRVPPRSDPSVEVRGLSRAGAFDDISFS
FT                   LAKGEIFGIAGLEGSGKSALLRALFGQRAYERGTVKVEGKDVQLTDITDAIRERFAFLP
FT                   AERKFEGIFPEHSVGWNLSIGNLGVLGKITLRPSKEKEVAASYISKLGVKCEGPQAEIS
FT                   SLSGGNQQKVMLARWLLTQPKVLLLEEPTRGVDVRAKSEVYALVQAAAQDGCTVIVVSA
FT                   DNAELLGLCHRVAVMFEGKITTVVDAATSKEETLALHSVRPPETLHPVGGING"
     MANNPLLEMK GIGKRFGNMV ALQGIDLALS GGEVLGLVGE NGAGKSTLMK ILAGAYSRDG        60
     GTIAVRGKEV ELDSPKAGAD AGIAIIYQEL SLFPDFNAAE NIFAGRELRR SGFSLAPLSH       120
     GQMRREARRL LSEELGVEVA IDRPVRELSL SDRQMIEIAK ALNSNADIII MDEPTEALEE       180
     VERKQLFAII NRLQAAGKAI IYVSHRIKEL LGICSRVMVL RDGRTAADLP VADLDVDKVV       240
     AAMIGGALSK QFPPRVPPRS DPSVEVRGLS RAGAFDDISF SLAKGEIFGI AGLEGSGKSA       300
     LLRALFGQRA YERGTVKVEG KDVQLTDITD AIRERFAFLP AERKFEGIFP EHSVGWNLSI       360
     GNLGVLGKIT LRPSKEKEVA ASYISKLGVK CEGPQAEISS LSGGNQQKVM LARWLLTQPK       420
     VLLLEEPTRG VDVRAKSEVY ALVQAAAQDG CTVIVVSADN AELLGLCHRV AVMFEGKITT       480
     VVDAATSKEE TLALHSVRPP ETLHPVGGIN G                                      511
//

If you have problems or comments...

PBIL Back to PBIL home page