(data stored in ACNUC7421 zone)

EMBL: CP001389.PE622

CP001389.PE622       Location/Qualifiers
FT   CDS             688520..688744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24426"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI78"
FT                   /protein_id="ACP24426.1"
FT                   /translation="MRRAFLLSSWSTTICILVEFAQLPFRSEAICRSKPYSDRRENPRG
FT                   RVLLRKGLRRLLSTKFLTAVRLPVCLTMV"
     MRRAFLLSSW STTICILVEF AQLPFRSEAI CRSKPYSDRR ENPRGRVLLR KGLRRLLSTK        60
     FLTAVRLPVC LTMV                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page