(data stored in ACNUC7421 zone)

EMBL: CP001389.PE623

CP001389.PE623       Location/Qualifiers
FT   CDS             688806..689903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06340"
FT                   /product="putative exported solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24427"
FT                   /db_xref="GOA:C3MI79"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI79"
FT                   /protein_id="ACP24427.1"
FT                   /translation="MRIGSLICGGIAALIVAMTTSAQAETRTLRFQSAYPASSTIYMSA
FT                   ETWAKRVEELSGGRLKIEFMPAGTIVPAFEVLDAVNKNVIDGGHSTVAYWVGKHRAGTL
FT                   FGDAAGGPFGMDILDYVGWLYEGGGIELYRDYYRVELKTNIEVIPSVTSANQALGWFAR
FT                   PVESWADLKGRKCRQTGVTAEVFASSGMSTVNMPGGEIVPAGERGVIECAEFVGPAEDM
FT                   GIGFQTIWKHFYPMSTHNPATIVDFLVNGDVWNSLAPDLQAIMQAAASEATLRSHIRKG
FT                   KLDADALDKMRNEDGVTVHRTPDDILRNILASWDEIAKKESESNAFFKKVYDSQRDYAS
FT                   KVVPAKRLIQAPYNLGADHYWPEAK"
     MRIGSLICGG IAALIVAMTT SAQAETRTLR FQSAYPASST IYMSAETWAK RVEELSGGRL        60
     KIEFMPAGTI VPAFEVLDAV NKNVIDGGHS TVAYWVGKHR AGTLFGDAAG GPFGMDILDY       120
     VGWLYEGGGI ELYRDYYRVE LKTNIEVIPS VTSANQALGW FARPVESWAD LKGRKCRQTG       180
     VTAEVFASSG MSTVNMPGGE IVPAGERGVI ECAEFVGPAE DMGIGFQTIW KHFYPMSTHN       240
     PATIVDFLVN GDVWNSLAPD LQAIMQAAAS EATLRSHIRK GKLDADALDK MRNEDGVTVH       300
     RTPDDILRNI LASWDEIAKK ESESNAFFKK VYDSQRDYAS KVVPAKRLIQ APYNLGADHY       360
     WPEAK                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page