(data stored in ACNUC7421 zone)

EMBL: CP001389.PE624

CP001389.PE624       Location/Qualifiers
FT   CDS             689959..690522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06350"
FT                   /product="putative transporter DctQ-related transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06350"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24428"
FT                   /db_xref="GOA:C3MI80"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI80"
FT                   /protein_id="ACP24428.1"
FT                   /translation="MSKPAPPFSPAALRAIKIIDGFTEKFVLLVAVLTIPLVLSNTVEV
FT                   VSRYLFSSPTIWAADATVMSYGAIFMLGSSYALLKGAHVRTDIFWESFSDRKKGAIDAV
FT                   CYVALFLPVMAIIFYMSLDDFLYSYEINEKSTLSLWMPVIWPLRGVIPLTAVLLFFQGI
FT                   SELLKSLFAVTTGRAFETHEKIEI"
     MSKPAPPFSP AALRAIKIID GFTEKFVLLV AVLTIPLVLS NTVEVVSRYL FSSPTIWAAD        60
     ATVMSYGAIF MLGSSYALLK GAHVRTDIFW ESFSDRKKGA IDAVCYVALF LPVMAIIFYM       120
     SLDDFLYSYE INEKSTLSLW MPVIWPLRGV IPLTAVLLFF QGISELLKSL FAVTTGRAFE       180
     THEKIEI                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page