(data stored in ACNUC7421 zone)

EMBL: CP001389.PE625

CP001389.PE625       Location/Qualifiers
FT   CDS             690535..691872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06360"
FT                   /product="putative TRAP family transmembrane transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24429"
FT                   /db_xref="GOA:C3MI81"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI81"
FT                   /protein_id="ACP24429.1"
FT                   /translation="MSFNDILSVAMLGGMLAFIFVGFPIAFTLLFIALVFGSIGIGVNI
FT                   TFSLAYLQIFGTMKDDILPAVPLFIFMGYMTEQAGLMNRLFGSMRQIMAPLSGSLFLAV
FT                   LLTATIFAMATGIVGAAVTVLGIMAGPMMIKAGYDAKLSAGAIAAGGTLGILIPPSVML
FT                   VVMGPTLGVPVNQLYGAAMAPGFMLAVCYATYCVARSYINPRVGPILPIEERVGSAIEI
FT                   TREFVVGVLPLCLLIVATLGSILSGLATPTEAASCGAVGATILALAYRKLSFWTLKNAA
FT                   VATVVTSSMVLLLAVASNVFGAVFTQQGGAAIITDVVTSIPVSDMWKLVIIMVIIFALG
FT                   WPFEWPAIVLVFLPIFTPIVLQLDLGMTKPELLLWFGVLVAVNLQTAYLSPPVAMSAYF
FT                   LRNVVPQWSLKLIYSGMGQFMVIQIVFLIALLMWPSLVLWLPSVLK"
     MSFNDILSVA MLGGMLAFIF VGFPIAFTLL FIALVFGSIG IGVNITFSLA YLQIFGTMKD        60
     DILPAVPLFI FMGYMTEQAG LMNRLFGSMR QIMAPLSGSL FLAVLLTATI FAMATGIVGA       120
     AVTVLGIMAG PMMIKAGYDA KLSAGAIAAG GTLGILIPPS VMLVVMGPTL GVPVNQLYGA       180
     AMAPGFMLAV CYATYCVARS YINPRVGPIL PIEERVGSAI EITREFVVGV LPLCLLIVAT       240
     LGSILSGLAT PTEAASCGAV GATILALAYR KLSFWTLKNA AVATVVTSSM VLLLAVASNV       300
     FGAVFTQQGG AAIITDVVTS IPVSDMWKLV IIMVIIFALG WPFEWPAIVL VFLPIFTPIV       360
     LQLDLGMTKP ELLLWFGVLV AVNLQTAYLS PPVAMSAYFL RNVVPQWSLK LIYSGMGQFM       420
     VIQIVFLIAL LMWPSLVLWL PSVLK                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page