(data stored in ACNUC7421 zone)

EMBL: CP001389.PE626

CP001389.PE626       Location/Qualifiers
FT   CDS             692205..693206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06370"
FT                   /product="putative AraC family transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24430"
FT                   /db_xref="GOA:C3MI82"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI82"
FT                   /protein_id="ACP24430.1"
FT                   /translation="MRRGNLAGKEDYVVVECTDPAELSSILSGSETKVTVKPTARSGIQ
FT                   FRCEYAAAELLGLALCRYQGSAVFEHESANEKYLIFLPRYGFAAINVNGARVLTSPRQG
FT                   AIVACQQAKSLTLSGPMEHLVVVVDRATLSSRLMDMLEVPVSGGFDFFPEIDLTAGPGL
FT                   IIAQTAAALHSGLAASAALRNAPVARTSFANALVELLLESLPHRHTSELNRRTSPMPRH
FT                   VKRAVEFMRANLSKPLTIQEIALASGSGIRSLQDGFRRFKQTTPSSYLQYLRLDAVHQE
FT                   LLQAKSSQTVCDIARKWGFSHSGRFAADYRKRFGQAPSQTLQSSSFRIRPPG"
     MRRGNLAGKE DYVVVECTDP AELSSILSGS ETKVTVKPTA RSGIQFRCEY AAAELLGLAL        60
     CRYQGSAVFE HESANEKYLI FLPRYGFAAI NVNGARVLTS PRQGAIVACQ QAKSLTLSGP       120
     MEHLVVVVDR ATLSSRLMDM LEVPVSGGFD FFPEIDLTAG PGLIIAQTAA ALHSGLAASA       180
     ALRNAPVART SFANALVELL LESLPHRHTS ELNRRTSPMP RHVKRAVEFM RANLSKPLTI       240
     QEIALASGSG IRSLQDGFRR FKQTTPSSYL QYLRLDAVHQ ELLQAKSSQT VCDIARKWGF       300
     SHSGRFAADY RKRFGQAPSQ TLQSSSFRIR PPG                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page