(data stored in ACNUC7421 zone)

EMBL: CP001389.PE628

CP001389.PE628       Location/Qualifiers
FT   CDS             694506..695387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06390"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24432"
FT                   /db_xref="GOA:C3MI84"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI84"
FT                   /protein_id="ACP24432.1"
FT                   /translation="MSAKRKLIIEARLNEYMSRSANPNVPFTAEEIALEAAKAREAGAS
FT                   IVHFHARGAEGAPAHGAEDYAKAITAIRDACDCLVYPTLGQITKDGRESRLAHLEVLAK
FT                   DPATRPDIAPIDTGSTNIDRFDPEARKFLSDTMTYRNDVATLKLFAKRLPELGVKPQFV
FT                   SWTVAFTRTFEALREMGLVVDPAYLMFELTDQGILGGHPGTVKGLLAHLDFLPAQPLEW
FT                   SVCNKIGNITAPAAAAIEMGGHVSVGLGDYGWPELGTPNNGDVVRHIANLARAMGREIA
FT                   APDEAREMLGLR"
     MSAKRKLIIE ARLNEYMSRS ANPNVPFTAE EIALEAAKAR EAGASIVHFH ARGAEGAPAH        60
     GAEDYAKAIT AIRDACDCLV YPTLGQITKD GRESRLAHLE VLAKDPATRP DIAPIDTGST       120
     NIDRFDPEAR KFLSDTMTYR NDVATLKLFA KRLPELGVKP QFVSWTVAFT RTFEALREMG       180
     LVVDPAYLMF ELTDQGILGG HPGTVKGLLA HLDFLPAQPL EWSVCNKIGN ITAPAAAAIE       240
     MGGHVSVGLG DYGWPELGTP NNGDVVRHIA NLARAMGREI AAPDEAREML GLR              293
//

If you have problems or comments...

PBIL Back to PBIL home page