(data stored in ACNUC7421 zone)

EMBL: CP001389.PE631

CP001389.PE631       Location/Qualifiers
FT   CDS             697284..698630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24435"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI87"
FT                   /protein_id="ACP24435.1"
FT                   /translation="MEGKRPLVGFYGDDFTGSSENLAQFHRNGLRTRLYLRVPSQETLA
FT                   EATRDLDVVGFAGTARALDNSQITAEVFPAFKALGALGCTFLQYKICSTFDSAPQVGNF
FT                   GFAAEQLAGGGGEYDLVVLAATPDFGRYTAFGNHYAKFGSEIVRLDRHPSMSNHPRTPM
FT                   KESDLRRHLADLCSLDFTNIFLPEIRDEATLSKRLENLLANRKGVVFDGVDNRDLDNIA
FT                   SALWEHHKKRPVFAIAAQGLAQALGKQLAKHKNPLDLLDVGTTIAPASNLLVLSGSCAI
FT                   QTGRQIDAAVQAGWAALELNPLELTDGRAVARKIELVKPQIMAHLANERPTIVYTARGH
FT                   AMDRDRFEDIPPQLIGEAYANLMVAARRETDVQRVVLAGGDSSSYAVRQSAAESLTIKV
FT                   FDRVQHGHLCELMGGGLDGLEVLLKGGQVGDDDYFMRVLHGTEKQHVEA"
     MEGKRPLVGF YGDDFTGSSE NLAQFHRNGL RTRLYLRVPS QETLAEATRD LDVVGFAGTA        60
     RALDNSQITA EVFPAFKALG ALGCTFLQYK ICSTFDSAPQ VGNFGFAAEQ LAGGGGEYDL       120
     VVLAATPDFG RYTAFGNHYA KFGSEIVRLD RHPSMSNHPR TPMKESDLRR HLADLCSLDF       180
     TNIFLPEIRD EATLSKRLEN LLANRKGVVF DGVDNRDLDN IASALWEHHK KRPVFAIAAQ       240
     GLAQALGKQL AKHKNPLDLL DVGTTIAPAS NLLVLSGSCA IQTGRQIDAA VQAGWAALEL       300
     NPLELTDGRA VARKIELVKP QIMAHLANER PTIVYTARGH AMDRDRFEDI PPQLIGEAYA       360
     NLMVAARRET DVQRVVLAGG DSSSYAVRQS AAESLTIKVF DRVQHGHLCE LMGGGLDGLE       420
     VLLKGGQVGD DDYFMRVLHG TEKQHVEA                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page