(data stored in ACNUC7421 zone)

EMBL: CP001389.PE632

CP001389.PE632       Location/Qualifiers
FT   CDS             698632..699513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24436"
FT                   /db_xref="GOA:C3MI88"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI88"
FT                   /protein_id="ACP24436.1"
FT                   /translation="MKKLILEARINEYAMRDHNRNVPWTSDEIAETAARVREEGASILH
FT                   FHARTVDGQPWNTFEAYDDIIRKVKAKSDILILPTLGFISNDADARNRIDNVVRLAQDP
FT                   ITKPDIAPIDTGSANLETFDRESGNVSFAERIYVNTTDSLVHYARELKQAGVKPKMVSW
FT                   SVGFTRRALMLMDMGLIDEPGYMLFHMTDGKTITGHPGTRQGLEAHLMFLPPDRRIEWT
FT                   ANVLGGNLLALADTIATRGGHLAMGIGDYPYPELDYPSNEVLIRETVRVIRAAGREPAT
FT                   PEEVRQMLDLSN"
     MKKLILEARI NEYAMRDHNR NVPWTSDEIA ETAARVREEG ASILHFHART VDGQPWNTFE        60
     AYDDIIRKVK AKSDILILPT LGFISNDADA RNRIDNVVRL AQDPITKPDI APIDTGSANL       120
     ETFDRESGNV SFAERIYVNT TDSLVHYARE LKQAGVKPKM VSWSVGFTRR ALMLMDMGLI       180
     DEPGYMLFHM TDGKTITGHP GTRQGLEAHL MFLPPDRRIE WTANVLGGNL LALADTIATR       240
     GGHLAMGIGD YPYPELDYPS NEVLIRETVR VIRAAGREPA TPEEVRQMLD LSN              293
//

If you have problems or comments...

PBIL Back to PBIL home page