(data stored in ACNUC7421 zone)

EMBL: CP001389.PE634

CP001389.PE634       Location/Qualifiers
FT   CDS             700038..700445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06450"
FT                   /product="putative short chain oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24438"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI90"
FT                   /protein_id="ACP24438.1"
FT                   /translation="MVANGNGRILIVSSVSATSPTPFETTYGPSKAFGFSFAESLREEL
FT                   RGTGVTVTALLPGATNTKFHANAGMADTPIGKAMKNDRELVAKQGFDALMNDIDHVVGG
FT                   DDATKQVVIENRKLTETVKAARHAAIARIGT"
     MVANGNGRIL IVSSVSATSP TPFETTYGPS KAFGFSFAES LREELRGTGV TVTALLPGAT        60
     NTKFHANAGM ADTPIGKAMK NDRELVAKQG FDALMNDIDH VVGGDDATKQ VVIENRKLTE       120
     TVKAARHAAI ARIGT                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page