(data stored in ACNUC7421 zone)

EMBL: CP001389.PE637

CP001389.PE637       Location/Qualifiers
FT   CDS             complement(703507..704373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24441"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI93"
FT                   /protein_id="ACP24441.1"
FT                   /translation="MGAHSVWVLEYARSPVHPVSGVYYGAHNQGTMNLPFAYILIRTAD
FT                   AVALVDVGHDANDFGGEIANSIGVTGWTPPEIVLGECGVRPEDVTHIFITHAHFDHIGG
FT                   LKFFPNAKIFIQKKELESWMWILAKGRRFRSLLAGLNPADILYLTQANIEGRLELLEGP
FT                   REDVLPGIHLYPAHDTHTAGSQYVVVQNRGSDDRLVLSGDVVYTYRNLTGDDQLDPCFV
FT                   PPGLANGSQTKLIQAAEEMLGIVGNDERRIIPVHEEKLAQFYPSRLSDHGLRIVEICVA
FT                   DGEQSRV"
     MGAHSVWVLE YARSPVHPVS GVYYGAHNQG TMNLPFAYIL IRTADAVALV DVGHDANDFG        60
     GEIANSIGVT GWTPPEIVLG ECGVRPEDVT HIFITHAHFD HIGGLKFFPN AKIFIQKKEL       120
     ESWMWILAKG RRFRSLLAGL NPADILYLTQ ANIEGRLELL EGPREDVLPG IHLYPAHDTH       180
     TAGSQYVVVQ NRGSDDRLVL SGDVVYTYRN LTGDDQLDPC FVPPGLANGS QTKLIQAAEE       240
     MLGIVGNDER RIIPVHEEKL AQFYPSRLSD HGLRIVEICV ADGEQSRV                    288
//

If you have problems or comments...

PBIL Back to PBIL home page