(data stored in ACNUC7421 zone)

EMBL: CP001389.PE638

CP001389.PE638       Location/Qualifiers
FT   CDS             complement(704345..704845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24442"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI94"
FT                   /protein_id="ACP24442.1"
FT                   /translation="MGYQRALIPFSCNEVANAVELQEQRSGLETLVRAYGEVLALFSFM
FT                   HLGLREPGMNLLFAQLSCRAADILESVGQGGDKRRRLAALEHAARHLGRVRSDLLQAQR
FT                   SFEGLLGRQSTELLRLLTRASLELKRASALLGTMTFDASGCCAGPLFANAEETHGSAFR
FT                   LGA"
     MGYQRALIPF SCNEVANAVE LQEQRSGLET LVRAYGEVLA LFSFMHLGLR EPGMNLLFAQ        60
     LSCRAADILE SVGQGGDKRR RLAALEHAAR HLGRVRSDLL QAQRSFEGLL GRQSTELLRL       120
     LTRASLELKR ASALLGTMTF DASGCCAGPL FANAEETHGS AFRLGA                      166
//

If you have problems or comments...

PBIL Back to PBIL home page