(data stored in ACNUC7421 zone)

EMBL: CP001389.PE639

CP001389.PE639       Location/Qualifiers
FT   CDS             complement(704851..705894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06500"
FT                   /product="putative aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24443"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI95"
FT                   /protein_id="ACP24443.1"
FT                   /translation="MMSDLAKRPLGKSNVRVTSLGLGTVPISGFNADVSYDEFEQTILS
FT                   GYAAGIRYFDCAPMYGFGKSEHFLGHALRVNKLRDDVVVSTKVGRVLKPASRTKKLDTV
FT                   YGIEWIDPLPFLDTYDYTYDGIMRSFEDSQQRLGLDYIDVLLVHDVGRAWHGDRSEFYW
FT                   DQLRASGYKALDELRSTGCVSAIGLGVNETDSVVGVSREFPIECALVAGRYTLLNHEPL
FT                   HSAFDELLSRNVSIIAGGIFNSGILASGTSGATATYDYGKVPAAVLDRVKSIEAVCEEY
FT                   RVSLPAAAMQFVYAHPAVATLVMGAKSSAEVDQNVAAINERIPPAFWNALQSADLLPAT
FT                   APLPAEA"
     MMSDLAKRPL GKSNVRVTSL GLGTVPISGF NADVSYDEFE QTILSGYAAG IRYFDCAPMY        60
     GFGKSEHFLG HALRVNKLRD DVVVSTKVGR VLKPASRTKK LDTVYGIEWI DPLPFLDTYD       120
     YTYDGIMRSF EDSQQRLGLD YIDVLLVHDV GRAWHGDRSE FYWDQLRASG YKALDELRST       180
     GCVSAIGLGV NETDSVVGVS REFPIECALV AGRYTLLNHE PLHSAFDELL SRNVSIIAGG       240
     IFNSGILASG TSGATATYDY GKVPAAVLDR VKSIEAVCEE YRVSLPAAAM QFVYAHPAVA       300
     TLVMGAKSSA EVDQNVAAIN ERIPPAFWNA LQSADLLPAT APLPAEA                     347
//

If you have problems or comments...

PBIL Back to PBIL home page