(data stored in ACNUC7421 zone)

EMBL: CP001389.PE640

CP001389.PE640       Location/Qualifiers
FT   CDS             complement(705922..706824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06510"
FT                   /product="putative aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24444"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI96"
FT                   /protein_id="ACP24444.1"
FT                   /translation="MRYFDTAPLYGLGKSEHSLGHVLRVNGIIEDVVISTKAGRILKPA
FT                   SRSKRAESLYGINWIDPLPYVDEYDYTYDGIMRSFEDSQQRMGVDGVDILYLHDVSGVW
FT                   HRDSYDLYLSQLRQSGYRACDELRSSGAVKAIGLGVNETASVLQVAAEFNLDCSLVAGR
FT                   YTLLNHQPLEDFFPEAQRRGIAIIAGGVYNSGVLAEGSKGAAAVRTYDYQTASPEILKR
FT                   VEALEAVCGEFGISLATAATQFVYSHPAVTAVVQGALSTAHVEANVKAISEKIPPGFWS
FT                   ALKAKSLIPEAAPIMTSAA"
     MRYFDTAPLY GLGKSEHSLG HVLRVNGIIE DVVISTKAGR ILKPASRSKR AESLYGINWI        60
     DPLPYVDEYD YTYDGIMRSF EDSQQRMGVD GVDILYLHDV SGVWHRDSYD LYLSQLRQSG       120
     YRACDELRSS GAVKAIGLGV NETASVLQVA AEFNLDCSLV AGRYTLLNHQ PLEDFFPEAQ       180
     RRGIAIIAGG VYNSGVLAEG SKGAAAVRTY DYQTASPEIL KRVEALEAVC GEFGISLATA       240
     ATQFVYSHPA VTAVVQGALS TAHVEANVKA ISEKIPPGFW SALKAKSLIP EAAPIMTSAA       300
//

If you have problems or comments...

PBIL Back to PBIL home page