(data stored in ACNUC7421 zone)

EMBL: CP001389.PE642

CP001389.PE642       Location/Qualifiers
FT   CDS             complement(708048..709034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06530"
FT                   /product="hypothetical ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24446"
FT                   /db_xref="GOA:C3MI98"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI98"
FT                   /protein_id="ACP24446.1"
FT                   /translation="MNANITKIATGTPSERRKAEITKDFIKSFSIILVFLAICVLFTSL
FT                   NQYFLTWNNWLNLLRQSSINGILAIGVTFVILTKGIDLSVGSVMALAGMMAANLVTTGN
FT                   EHLVIWSILAALGTGAVVGLANGVLIARINVPPFVATLGMLSMARGLTLIYSDGRPIAN
FT                   LTASLRWIGSGNVLGLPVPVLIFFAVFLIGWLTLSRTTFGRYVYAVGGNEKAARTSGIS
FT                   TRTIIAATYVICGLLAGLAGLVLTARTTAALPQAGIGYELDAIAAVVIGGTSLSGGRGS
FT                   LVGTLFGALIIGTINNGMDLMGVSSYYQQLLKGAIIVLAVIADQIRK"
     MNANITKIAT GTPSERRKAE ITKDFIKSFS IILVFLAICV LFTSLNQYFL TWNNWLNLLR        60
     QSSINGILAI GVTFVILTKG IDLSVGSVMA LAGMMAANLV TTGNEHLVIW SILAALGTGA       120
     VVGLANGVLI ARINVPPFVA TLGMLSMARG LTLIYSDGRP IANLTASLRW IGSGNVLGLP       180
     VPVLIFFAVF LIGWLTLSRT TFGRYVYAVG GNEKAARTSG ISTRTIIAAT YVICGLLAGL       240
     AGLVLTARTT AALPQAGIGY ELDAIAAVVI GGTSLSGGRG SLVGTLFGAL IIGTINNGMD       300
     LMGVSSYYQQ LLKGAIIVLA VIADQIRK                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page