(data stored in ACNUC7421 zone)

EMBL: CP001389.PE643

CP001389.PE643       Location/Qualifiers
FT   CDS             complement(709105..710652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06540"
FT                   /product="hypothetical ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24447"
FT                   /db_xref="GOA:C3MI99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI99"
FT                   /protein_id="ACP24447.1"
FT                   /translation="MALGGFMTTGSVTFDTTLHSTTGNGLLLEADGVAKAFHGVPALRN
FT                   GHLKLRPGSVHALCGGNGAGKSTFLNIVMGLLRRDEGSIKIKGEVVDFRSASEALDHGI
FT                   AIITQELSPVLEMTVAENIYLGREPKRLGAFIDFALLETQAQKLLDDIGFPIRANARMS
FT                   NLSLAETQLVEIAKALSFDADIVIMDEPTSAIGEHEAHILFAAIDRLKHRGSGIIYVSH
FT                   KLSEIFEIADEFTVFRDGNYIVSGSMKETTRKELVTHIVGREVKVVEKERPNAGAPILL
FT                   EVRNLSRESEFKDISISVAAGEVFGIYGLLGSGRTEFLEAVYGMETPTSGEVMLAGRPV
FT                   PRGKPRESIKMGMAMVSEDRKDSGLVLSSSIAHNITLSALSLMAVSGFVKQQKEREVVE
FT                   EMIRSQRIKTSSSELAVENLSGGNQQKVVFARCLTTNPRLLICDEPTRGIDEGSKQEIY
FT                   AFLRDFAAKGHGVLVVSSEAPEILQVSDRIAIFKAGTLVDVIDGHGATQQMIMELAS"
     MALGGFMTTG SVTFDTTLHS TTGNGLLLEA DGVAKAFHGV PALRNGHLKL RPGSVHALCG        60
     GNGAGKSTFL NIVMGLLRRD EGSIKIKGEV VDFRSASEAL DHGIAIITQE LSPVLEMTVA       120
     ENIYLGREPK RLGAFIDFAL LETQAQKLLD DIGFPIRANA RMSNLSLAET QLVEIAKALS       180
     FDADIVIMDE PTSAIGEHEA HILFAAIDRL KHRGSGIIYV SHKLSEIFEI ADEFTVFRDG       240
     NYIVSGSMKE TTRKELVTHI VGREVKVVEK ERPNAGAPIL LEVRNLSRES EFKDISISVA       300
     AGEVFGIYGL LGSGRTEFLE AVYGMETPTS GEVMLAGRPV PRGKPRESIK MGMAMVSEDR       360
     KDSGLVLSSS IAHNITLSAL SLMAVSGFVK QQKEREVVEE MIRSQRIKTS SSELAVENLS       420
     GGNQQKVVFA RCLTTNPRLL ICDEPTRGID EGSKQEIYAF LRDFAAKGHG VLVVSSEAPE       480
     ILQVSDRIAI FKAGTLVDVI DGHGATQQMI MELAS                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page