(data stored in ACNUC7421 zone)

EMBL: CP001389.PE644

CP001389.PE644       Location/Qualifiers
FT   CDS             710750..711763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24448"
FT                   /db_xref="GOA:C3MIA0"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIA0"
FT                   /protein_id="ACP24448.1"
FT                   /translation="MIIDVAADPAAGITSAVEALGRGDVIAVPTETVYGLAADATNEAA
FT                   VSQIFDIKRRPGFNPLICHCSDLEMVSEFATLDPVSLRLAERFWPGPMTLVLNSNPGRL
FT                   PSVTTAGLTTVAIRIPMGFSNGLIRSYGGPLAAPSANISGRVSATTAAHVESEFGDGVP
FT                   LILDGGPTKIGVESTILRVRENGIELLRPGGLPIELVEHAAGLQVSAPNLFRKVLAPGM
FT                   LTSHYAPRAMVRLNATGVGPGETLLKFGDAIVPGEGACARVFNLSPEGSLEEFAAKLYA
FT                   TLKEADDAGAESIAIVPIPDEGLGLAINDRLRRAAAPRTLTLGELEQAAVRNREAR"
     MIIDVAADPA AGITSAVEAL GRGDVIAVPT ETVYGLAADA TNEAAVSQIF DIKRRPGFNP        60
     LICHCSDLEM VSEFATLDPV SLRLAERFWP GPMTLVLNSN PGRLPSVTTA GLTTVAIRIP       120
     MGFSNGLIRS YGGPLAAPSA NISGRVSATT AAHVESEFGD GVPLILDGGP TKIGVESTIL       180
     RVRENGIELL RPGGLPIELV EHAAGLQVSA PNLFRKVLAP GMLTSHYAPR AMVRLNATGV       240
     GPGETLLKFG DAIVPGEGAC ARVFNLSPEG SLEEFAAKLY ATLKEADDAG AESIAIVPIP       300
     DEGLGLAIND RLRRAAAPRT LTLGELEQAA VRNREAR                                337
//

If you have problems or comments...

PBIL Back to PBIL home page