(data stored in ACNUC7421 zone)

EMBL: CP001389.PE654

CP001389.PE654       Location/Qualifiers
FT   CDS             723018..724892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06650"
FT                   /product="putative methyl-accepting chemotaxis receptor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24458"
FT                   /db_xref="GOA:C3MIB0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB0"
FT                   /protein_id="ACP24458.1"
FT                   /translation="MRDIREFGVALRLSIAFGLLLFAMGVLSLSSIRQVNEINAKLSLI
FT                   NGSNSQKYRNGIDMLGTVRDRAMALRDIVLTDSDTDKATTIAMMKKLQASYASNAAELQ
FT                   KAVNADVFSTAAEHRLVDGLKAFQNEAEPLIAEVIKLTLDGKKDQAKPLLLNQLRPKLT
FT                   AWIGALNKLIDYEQALNQGVGGKVKAASDEFKSLTLTALSVAALFGIFAAALTTRSIIA
FT                   PLAKLQQSVRQMIAGDMQIDRVIERRMDEIGQLARQISSLKTHLSEKAERDAVAEHHRQ
FT                   DAERQRLETEGEERQRAAEQTSSAVEQVAEALKQLSKGNLHIQLDRPFTEALEPLRLDF
FT                   NSAISQLRDAMFEVNYNAQAIAAGAEEIRTSSSELATRTEQQALVVEQTASVLADMTRQ
FT                   VVDASHRAHEAGVLVGETKENVERSGTIMRDAVEAMTKIRASSLEIGDIIGVIDEIASQ
FT                   TNLLALNAGIEAARAGETGRGFAVVAQEVRDLAQRSAAAAKEIKSLVEVSNLHINDGVQ
FT                   RVHQAGDALGQIVVQVQSVNQNVDAIAQVSRTQADGLKDINFSVEKIESATQQNAAMVE
FT                   ESTAAVHNLAKEAASLFEMLSRFQMDDGPADTKRVEESAFSVAVASSA"
     MRDIREFGVA LRLSIAFGLL LFAMGVLSLS SIRQVNEINA KLSLINGSNS QKYRNGIDML        60
     GTVRDRAMAL RDIVLTDSDT DKATTIAMMK KLQASYASNA AELQKAVNAD VFSTAAEHRL       120
     VDGLKAFQNE AEPLIAEVIK LTLDGKKDQA KPLLLNQLRP KLTAWIGALN KLIDYEQALN       180
     QGVGGKVKAA SDEFKSLTLT ALSVAALFGI FAAALTTRSI IAPLAKLQQS VRQMIAGDMQ       240
     IDRVIERRMD EIGQLARQIS SLKTHLSEKA ERDAVAEHHR QDAERQRLET EGEERQRAAE       300
     QTSSAVEQVA EALKQLSKGN LHIQLDRPFT EALEPLRLDF NSAISQLRDA MFEVNYNAQA       360
     IAAGAEEIRT SSSELATRTE QQALVVEQTA SVLADMTRQV VDASHRAHEA GVLVGETKEN       420
     VERSGTIMRD AVEAMTKIRA SSLEIGDIIG VIDEIASQTN LLALNAGIEA ARAGETGRGF       480
     AVVAQEVRDL AQRSAAAAKE IKSLVEVSNL HINDGVQRVH QAGDALGQIV VQVQSVNQNV       540
     DAIAQVSRTQ ADGLKDINFS VEKIESATQQ NAAMVEESTA AVHNLAKEAA SLFEMLSRFQ       600
     MDDGPADTKR VEESAFSVAV ASSA                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page