(data stored in ACNUC7421 zone)

EMBL: CP001389.PE656

CP001389.PE656       Location/Qualifiers
FT   CDS             726251..727471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06670"
FT                   /product="sugar ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24460"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB2"
FT                   /protein_id="ACP24460.1"
FT                   /translation="MKRLLCVATAVAMFLPVAVRAEEARVIHWWTSGGESDAIKVIADA
FT                   YKSDGGTWIDQAIAGSDSARLAATNAISGGQPPTMAQFNISNQFRELAEASFLRSLDDV
FT                   AADENWQAVLPGPILDVITVDGHIYAAPVNIHNPAWIWYSTEALQKAQVSEPPTTKNAF
FT                   FTALDKLKSAGIIPLALGGQPWQERATFDAVLLHFGGKDMYMNFIGGNGAALVQTPEFK
FT                   QVLADFKRLKGYVDEGSPNRSWNEATALVIENKAGFQIMGDWAKGEFKAAGDTAGKEYG
FT                   CIVGFGDKPSYMIAGDVFIFPKSNESDTAAQTHLAKLMLSPKVQVDFNNLKGSIPVRAG
FT                   VDGSNMDVCAQAGLAAVSDPSRQVPNPEMRLSPDAHGMVTDAISNFWNTDQSVDEAVAA
FT                   LQSALSM"
     MKRLLCVATA VAMFLPVAVR AEEARVIHWW TSGGESDAIK VIADAYKSDG GTWIDQAIAG        60
     SDSARLAATN AISGGQPPTM AQFNISNQFR ELAEASFLRS LDDVAADENW QAVLPGPILD       120
     VITVDGHIYA APVNIHNPAW IWYSTEALQK AQVSEPPTTK NAFFTALDKL KSAGIIPLAL       180
     GGQPWQERAT FDAVLLHFGG KDMYMNFIGG NGAALVQTPE FKQVLADFKR LKGYVDEGSP       240
     NRSWNEATAL VIENKAGFQI MGDWAKGEFK AAGDTAGKEY GCIVGFGDKP SYMIAGDVFI       300
     FPKSNESDTA AQTHLAKLML SPKVQVDFNN LKGSIPVRAG VDGSNMDVCA QAGLAAVSDP       360
     SRQVPNPEMR LSPDAHGMVT DAISNFWNTD QSVDEAVAAL QSALSM                      406
//

If you have problems or comments...

PBIL Back to PBIL home page