(data stored in ACNUC7421 zone)

EMBL: CP001389.PE658

CP001389.PE658       Location/Qualifiers
FT   CDS             728467..729330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06690"
FT                   /product="hypothetical ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24462"
FT                   /db_xref="GOA:C3MIB4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB4"
FT                   /protein_id="ACP24462.1"
FT                   /translation="MAYDNHPPQVRFAIYAVLVVAGIFYFLPIYVMIATSLKSMSEIRD
FT                   GSIFALPAAPSIDAWVRAWTSACTGLNCTGIRVGFWNSVSIVTPSVIVSIFFGALNGYA
FT                   LSFWRPRGGVWLLCGLLLGAFIPYQIFLFPLTKILVAVGLFKTLTGLVFVHTLFGMPIM
FT                   TLLFRNYFASVPSDLFNAARVDGAGFFAIFFFVMLPMATPIVIVAVIMQITAIWNDFLF
FT                   GLVFANSDRVPMTVQLNNIVNSTTGEREYNVNMAATILTSLVPVAVYLLSGKYFVRGIA
FT                   AGAVKG"
     MAYDNHPPQV RFAIYAVLVV AGIFYFLPIY VMIATSLKSM SEIRDGSIFA LPAAPSIDAW        60
     VRAWTSACTG LNCTGIRVGF WNSVSIVTPS VIVSIFFGAL NGYALSFWRP RGGVWLLCGL       120
     LLGAFIPYQI FLFPLTKILV AVGLFKTLTG LVFVHTLFGM PIMTLLFRNY FASVPSDLFN       180
     AARVDGAGFF AIFFFVMLPM ATPIVIVAVI MQITAIWNDF LFGLVFANSD RVPMTVQLNN       240
     IVNSTTGERE YNVNMAATIL TSLVPVAVYL LSGKYFVRGI AAGAVKG                     287
//

If you have problems or comments...

PBIL Back to PBIL home page