(data stored in ACNUC7421 zone)

EMBL: CP001389.PE659

CP001389.PE659       Location/Qualifiers
FT   CDS             729334..730401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06700"
FT                   /product="hypothetical ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24463"
FT                   /db_xref="GOA:C3MIB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB5"
FT                   /protein_id="ACP24463.1"
FT                   /translation="MTKNVSVKKLNIGYGAYTIVKDLDLDIAAGEFLVLLGPSGCGKST
FT                   LLSAFAGLAPVQSGAIHFGDRDVTRLAPKDRGVGMVFQSYALYPTMSVRRNISFGMKMA
FT                   GIRAAERERKVNEVADFLQISALLDRKPSQLSGGQRQRVAIGRALARDADIYLFDEPLS
FT                   NLDAKLRTELRYEIRRLHSELGSTMIYVTHDQIEAMTLATRIAVMKSGVIQQLDRPNEI
FT                   YLRPANLFVAGFVGSPAMNLIKGRIDRAAGGGSIFVSAGFSLELKARYQSQEAILGVRP
FT                   EQFVSRDGPIKGKIEMTEDMGPDALFWLTVGGQRLSIRSSSSSLPQPGSEFSANVDQDV
FT                   ISLFSAESGVRLAAA"
     MTKNVSVKKL NIGYGAYTIV KDLDLDIAAG EFLVLLGPSG CGKSTLLSAF AGLAPVQSGA        60
     IHFGDRDVTR LAPKDRGVGM VFQSYALYPT MSVRRNISFG MKMAGIRAAE RERKVNEVAD       120
     FLQISALLDR KPSQLSGGQR QRVAIGRALA RDADIYLFDE PLSNLDAKLR TELRYEIRRL       180
     HSELGSTMIY VTHDQIEAMT LATRIAVMKS GVIQQLDRPN EIYLRPANLF VAGFVGSPAM       240
     NLIKGRIDRA AGGGSIFVSA GFSLELKARY QSQEAILGVR PEQFVSRDGP IKGKIEMTED       300
     MGPDALFWLT VGGQRLSIRS SSSSLPQPGS EFSANVDQDV ISLFSAESGV RLAAA            355
//

If you have problems or comments...

PBIL Back to PBIL home page