(data stored in ACNUC7421 zone)

EMBL: CP001389.PE66

CP001389.PE66        Location/Qualifiers
FT   CDS             complement(71654..73555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00660"
FT                   /product="DEAD/DEAH box protein, ATP-dependent RNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23870"
FT                   /db_xref="GOA:C3MF33"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF33"
FT                   /protein_id="ACP23870.1"
FT                   /translation="MTEFEGIAPAIAEALAKRGYNTLTPVQQAMLDPALEGADALVSAQ
FT                   TGSGKTVAFGLALGPTLLGPARQFDSPGAPLALVIAPTRELALQVKRELEWLYEITGAT
FT                   IASCVGGMDIRSERRALERGAHIVVGTPGRLCDHIRRDSLDISALRAIVLDEADEMLDL
FT                   GFREDLEFILEASPTERRTLMFSATVPRSIATLAKNYQRDAVRIGVASEQKQHGDIEYR
FT                   SLLVAPSDRENAIINVLRYYDARNAIVFCSTRAAVNHLTARFNNRGFSVVALSGELSQN
FT                   ERNHALQAMRDGRARVCIATDVAARGIDLPGLELVIHADLPTNPDTLLHRSGRTGRAGQ
FT                   KGVSALIVPVNQRRKAERLLDGARITATWAKPPSAEDVTGRDDERLIADAAFDEPLRDD
FT                   EQTIVQALIDRHGAEKLAAAFVRQFRSSRSAPEELSDVPLFDDRKKARRDAPAFTGDSA
FT                   AAPRADFTDGQWFSLSVGRKQNAEPRWLIPMLCRHGKLSKRDIGAIRMQPEETYVELTA
FT                   DGAERFLTAIGPNRTLEKGIRVKTLPGAPDGSRPRDDKPEFAKKRPRPAEAQPERGQKD
FT                   FQPKRKFEKKPPVSQDTNPEKRDEKPWSKKKGKPDARKAAGDFKPKAKRNNAKNRQA"
     MTEFEGIAPA IAEALAKRGY NTLTPVQQAM LDPALEGADA LVSAQTGSGK TVAFGLALGP        60
     TLLGPARQFD SPGAPLALVI APTRELALQV KRELEWLYEI TGATIASCVG GMDIRSERRA       120
     LERGAHIVVG TPGRLCDHIR RDSLDISALR AIVLDEADEM LDLGFREDLE FILEASPTER       180
     RTLMFSATVP RSIATLAKNY QRDAVRIGVA SEQKQHGDIE YRSLLVAPSD RENAIINVLR       240
     YYDARNAIVF CSTRAAVNHL TARFNNRGFS VVALSGELSQ NERNHALQAM RDGRARVCIA       300
     TDVAARGIDL PGLELVIHAD LPTNPDTLLH RSGRTGRAGQ KGVSALIVPV NQRRKAERLL       360
     DGARITATWA KPPSAEDVTG RDDERLIADA AFDEPLRDDE QTIVQALIDR HGAEKLAAAF       420
     VRQFRSSRSA PEELSDVPLF DDRKKARRDA PAFTGDSAAA PRADFTDGQW FSLSVGRKQN       480
     AEPRWLIPML CRHGKLSKRD IGAIRMQPEE TYVELTADGA ERFLTAIGPN RTLEKGIRVK       540
     TLPGAPDGSR PRDDKPEFAK KRPRPAEAQP ERGQKDFQPK RKFEKKPPVS QDTNPEKRDE       600
     KPWSKKKGKP DARKAAGDFK PKAKRNNAKN RQA                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page