(data stored in ACNUC7421 zone)

EMBL: CP001389.PE661

CP001389.PE661       Location/Qualifiers
FT   CDS             complement(733347..733625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24465"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB7"
FT                   /protein_id="ACP24465.1"
FT                   /translation="MFEIGAAGSMSGPGTRKRQPKNPVAADEIVSEAIASSKAGGRFRV
FT                   GGTRPSGSDFERGSETGNLALVEAATTAIEAAGGRVASTAEARRIIA"
     MFEIGAAGSM SGPGTRKRQP KNPVAADEIV SEAIASSKAG GRFRVGGTRP SGSDFERGSE        60
     TGNLALVEAA TTAIEAAGGR VASTAEARRI IA                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page