(data stored in ACNUC7421 zone)

EMBL: CP001389.PE662

CP001389.PE662       Location/Qualifiers
FT   CDS             complement(733637..734464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24466"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR031663"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037161"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB8"
FT                   /protein_id="ACP24466.1"
FT                   /translation="MTAVALFGAGGKMGCRLTKNLKGSRFDVRHVEVSAGGKARLEREL
FT                   GIGTVDVDQALDGVDVVILAVPDTAIGKVASSIEAKLRPGTMVIALDAAAPAAGHLPDR
FT                   PDLTYFVTHPCHPPIFNDETDPHAKRDFFGGVAAKQHIVSALMQGPEEHYALGEEIAKV
FT                   IWAPVMRSHRVTVEQIALLEPGLSETVCASLLVVMRQAMDECVARGVPKEAARDFLLGH
FT                   LNVLGAVIFEETPGVFSDACNKAIEFGIPALMKDDWKKVFEPKEIADSIRRIT"
     MTAVALFGAG GKMGCRLTKN LKGSRFDVRH VEVSAGGKAR LERELGIGTV DVDQALDGVD        60
     VVILAVPDTA IGKVASSIEA KLRPGTMVIA LDAAAPAAGH LPDRPDLTYF VTHPCHPPIF       120
     NDETDPHAKR DFFGGVAAKQ HIVSALMQGP EEHYALGEEI AKVIWAPVMR SHRVTVEQIA       180
     LLEPGLSETV CASLLVVMRQ AMDECVARGV PKEAARDFLL GHLNVLGAVI FEETPGVFSD       240
     ACNKAIEFGI PALMKDDWKK VFEPKEIADS IRRIT                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page