(data stored in ACNUC7421 zone)

EMBL: CP001389.PE663

CP001389.PE663       Location/Qualifiers
FT   CDS             complement(735090..735671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24467"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB9"
FT                   /protein_id="ACP24467.1"
FT                   /translation="MPNSYDPNRISALRALSKSGDDNGFRKAVDLHTERGLPIEEIQQA
FT                   IHASEWRYVVEGCGTSVALERRSELLGYYDDMLEHIEDALSTMTDLDDVRGGPKGMLRH
FT                   LEEREALGKDCFEALLEGRRVLQYLLPEDDLPDPKHDIGRLLSKSGFLWDGAYEVEKVP
FT                   GENEQIFNEAVKIMEYMLSTWSASRPVEEE"
     MPNSYDPNRI SALRALSKSG DDNGFRKAVD LHTERGLPIE EIQQAIHASE WRYVVEGCGT        60
     SVALERRSEL LGYYDDMLEH IEDALSTMTD LDDVRGGPKG MLRHLEEREA LGKDCFEALL       120
     EGRRVLQYLL PEDDLPDPKH DIGRLLSKSG FLWDGAYEVE KVPGENEQIF NEAVKIMEYM       180
     LSTWSASRPV EEE                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page