(data stored in ACNUC7421 zone)

EMBL: CP001389.PE67

CP001389.PE67        Location/Qualifiers
FT   CDS             complement(73709..74065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23871"
FT                   /db_xref="GOA:C3MF34"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF34"
FT                   /protein_id="ACP23871.1"
FT                   /translation="MTWLFFSPSGRIGRLPFFLSWLLWLVLGGIILMQMLKYEDQDAAL
FT                   ALWTLAMIGSGVASTVSIAMLAIKRLHDIGYPGPLALCLFIPVLSPIVFIALCLWPGAP
FT                   GANEFGGHRNGPRR"
     MTWLFFSPSG RIGRLPFFLS WLLWLVLGGI ILMQMLKYED QDAALALWTL AMIGSGVAST        60
     VSIAMLAIKR LHDIGYPGPL ALCLFIPVLS PIVFIALCLW PGAPGANEFG GHRNGPRR         118
//

If you have problems or comments...

PBIL Back to PBIL home page