(data stored in ACNUC7421 zone)

EMBL: CP001389.PE69

CP001389.PE69        Location/Qualifiers
FT   CDS             75258..76157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00690"
FT                   /product="conserved hypothetical protein, possible lysine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23873"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF36"
FT                   /protein_id="ACP23873.1"
FT                   /translation="MGRMKKRSLRGKGGVWDPLADSSQSRQRASTVPLTPQSASPTYRL
FT                   AYIDDDFLCREELRPVRLQLELLKTEMMLEERGINSTVVMFGGARIPEPGGEAWAAKNE
FT                   TQRKNLEAASVYYDEARKFARLCSEQSAKLGHKEYVIVTGGGPGVMEAGNRGAADVGAP
FT                   SIGLNIVLPHEQAPNSYVTPELSFNFHYFAIRKMHFLLRAKAVAVFPGGFGTLDELFET
FT                   MTLMQTGRLALVPLVLFGEKFWRSIINFEALAEFGTIAPNDIDLVHFVETAEEAWEIIA
FT                   RFYETVDPRSVPMASGRR"
     MGRMKKRSLR GKGGVWDPLA DSSQSRQRAS TVPLTPQSAS PTYRLAYIDD DFLCREELRP        60
     VRLQLELLKT EMMLEERGIN STVVMFGGAR IPEPGGEAWA AKNETQRKNL EAASVYYDEA       120
     RKFARLCSEQ SAKLGHKEYV IVTGGGPGVM EAGNRGAADV GAPSIGLNIV LPHEQAPNSY       180
     VTPELSFNFH YFAIRKMHFL LRAKAVAVFP GGFGTLDELF ETMTLMQTGR LALVPLVLFG       240
     EKFWRSIINF EALAEFGTIA PNDIDLVHFV ETAEEAWEII ARFYETVDPR SVPMASGRR        299
//

If you have problems or comments...

PBIL Back to PBIL home page