(data stored in ACNUC7421 zone)

EMBL: CP001389.PE71

CP001389.PE71        Location/Qualifiers
FT   CDS             77052..77966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00710"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23875"
FT                   /db_xref="GOA:C3MF38"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF38"
FT                   /protein_id="ACP23875.1"
FT                   /translation="METWVLITVAAAFLQNIRSSMQKHLKGAMGTTGATFVRFGFGLPF
FT                   ALLYLLMLWRVAGHPLPVPNATFFLWAAVGGMAQIAATFLLVHLFSFRNFAVGTAYSRT
FT                   EPAQAALFGLIFLGEKASQGTLVAIAISVVGVMLISVARTTLSTRSLLTSVFSPTAAIG
FT                   LFSGTFFGLSAVSYRSASLALAPSLPAPDFMMQASFTLGFVILLQTAVMLLWIVAREPD
FT                   ELKRIGSAWKPAFVVGFVGSSASFGWFMAMTLQQAAIVKVVAQVEMIFTFASSFFIFRE
FT                   WINRLELVGCLLIVLGVVMLLVL"
     METWVLITVA AAFLQNIRSS MQKHLKGAMG TTGATFVRFG FGLPFALLYL LMLWRVAGHP        60
     LPVPNATFFL WAAVGGMAQI AATFLLVHLF SFRNFAVGTA YSRTEPAQAA LFGLIFLGEK       120
     ASQGTLVAIA ISVVGVMLIS VARTTLSTRS LLTSVFSPTA AIGLFSGTFF GLSAVSYRSA       180
     SLALAPSLPA PDFMMQASFT LGFVILLQTA VMLLWIVARE PDELKRIGSA WKPAFVVGFV       240
     GSSASFGWFM AMTLQQAAIV KVVAQVEMIF TFASSFFIFR EWINRLELVG CLLIVLGVVM       300
     LLVL                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page