(data stored in ACNUC7421 zone)

EMBL: CP001389.PE73

CP001389.PE73        Location/Qualifiers
FT   CDS             complement(79080..80282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00730"
FT                   /product="integrase catalytic core domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23877"
FT                   /db_xref="GOA:C3MF40"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF40"
FT                   /protein_id="ACP23877.1"
FT                   /translation="MVWRETGIMEERLKFVAACLSGEETMAGLCALYGISRKTGYKWLR
FT                   RFQLRGPAGLEDLPRAPLNHGRATAAELVERIVAEKEAHPLWGPKKIVARLARQDPATA
FT                   WPSASTAGAILNRHGLVGRRRARWKGAGNGPWPEPAMPNAVWTGDHKGWFTTRDGWRCE
FT                   PLTVMDVKSRYLLALEATGSTGDEEAWPVFERLFDEHGLPDRIRTDNGPPFAAAGVTGL
FT                   TPLSLRFVRLGITLERIAPGKPQQNGKHERFHLTMLPLAKAPAADRAAQAEAFEAFRRE
FT                   YNEERPHETLGMDTPAEHYRASTRKMPVSPPEPDYPAEAAVRKVRHNGAVKWQGAEIYV
FT                   SATLVGEVVAIEETESGEWAMRFYAHRLGFIDEKRGRLVRKTVLQPRPAVGLADELREE
FT                   L"
     MVWRETGIME ERLKFVAACL SGEETMAGLC ALYGISRKTG YKWLRRFQLR GPAGLEDLPR        60
     APLNHGRATA AELVERIVAE KEAHPLWGPK KIVARLARQD PATAWPSAST AGAILNRHGL       120
     VGRRRARWKG AGNGPWPEPA MPNAVWTGDH KGWFTTRDGW RCEPLTVMDV KSRYLLALEA       180
     TGSTGDEEAW PVFERLFDEH GLPDRIRTDN GPPFAAAGVT GLTPLSLRFV RLGITLERIA       240
     PGKPQQNGKH ERFHLTMLPL AKAPAADRAA QAEAFEAFRR EYNEERPHET LGMDTPAEHY       300
     RASTRKMPVS PPEPDYPAEA AVRKVRHNGA VKWQGAEIYV SATLVGEVVA IEETESGEWA       360
     MRFYAHRLGF IDEKRGRLVR KTVLQPRPAV GLADELREEL                             400
//

If you have problems or comments...

PBIL Back to PBIL home page