(data stored in ACNUC7421 zone)

EMBL: CP001389.PE76

CP001389.PE76        Location/Qualifiers
FT   CDS             82146..82865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23880"
FT                   /db_xref="GOA:C3MF43"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF43"
FT                   /protein_id="ACP23880.1"
FT                   /translation="MTTQKPESGDSRRDEVIAGEYVLGVLSAEDRRQVEARMATDRNFA
FT                   AMVVRWQSNLAHIDMAYEPVTPPPHVFAAIESRVFESPASPKKSAGLWNSLSFWRSLAI
FT                   ASLAAVAVLGISMLELFSAGQGGKPLVAELQGQGNGLGLALVAQFDIGTGRLRVTPVAA
FT                   RQAEEKSLELWLIKGSDPAISLGVLPQSGEGEIRVSPAVRSKITEGSTLAVSLEPLGGS
FT                   PTGAATGPVIALGTTRR"
     MTTQKPESGD SRRDEVIAGE YVLGVLSAED RRQVEARMAT DRNFAAMVVR WQSNLAHIDM        60
     AYEPVTPPPH VFAAIESRVF ESPASPKKSA GLWNSLSFWR SLAIASLAAV AVLGISMLEL       120
     FSAGQGGKPL VAELQGQGNG LGLALVAQFD IGTGRLRVTP VAARQAEEKS LELWLIKGSD       180
     PAISLGVLPQ SGEGEIRVSP AVRSKITEGS TLAVSLEPLG GSPTGAATGP VIALGTTRR        239
//

If you have problems or comments...

PBIL Back to PBIL home page