(data stored in ACNUC7421 zone)

EMBL: CP001389.PE77

CP001389.PE77        Location/Qualifiers
FT   CDS             83058..83615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00770"
FT                   /product="conserved hypothetical protein contains
FT                   beta-Ig-H3/fasciclin domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00770"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23881"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF44"
FT                   /protein_id="ACP23881.1"
FT                   /translation="MFRSVFHSAALASILAVGATVAHAENPMVGGAPMYAEKNIVENAV
FT                   NSKDHTTLVAAVKAAGLVETLQGKGPFTVFAPTDDAFGALPTGTVDMLLKPENKDKLAK
FT                   VLTCHVVAADAMSSAIAKMIADDGGAHDVKTVGGCILKARSDGGKIGLTDETGSTAWVT
FT                   IADVKQSNGVIHVINKVLLPKG"
     MFRSVFHSAA LASILAVGAT VAHAENPMVG GAPMYAEKNI VENAVNSKDH TTLVAAVKAA        60
     GLVETLQGKG PFTVFAPTDD AFGALPTGTV DMLLKPENKD KLAKVLTCHV VAADAMSSAI       120
     AKMIADDGGA HDVKTVGGCI LKARSDGGKI GLTDETGSTA WVTIADVKQS NGVIHVINKV       180
     LLPKG                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page