(data stored in ACNUC7421 zone)

EMBL: CP001389.PE79

CP001389.PE79        Location/Qualifiers
FT   CDS             complement(84393..84932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00790"
FT                   /product="putative membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23883"
FT                   /db_xref="InterPro:IPR009200"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF46"
FT                   /protein_id="ACP23883.1"
FT                   /translation="MSDLIVIGFDTPEEADRVLLKLHSLKKEYLIDLEDAVVVVRDTDG
FT                   KVHLKQSINLPTVGAASGLLSGSLWGGLVGLLFLNPLAGFAIGGAIGAGAGALSGSLAD
FT                   YGIDDDFIKSLGSTIPNNSSALFILVRKVQPEKVLAELSGLRGRVLKTSLSPEQEHKLQ
FT                   AALSDAQTPSPPAGTF"
     MSDLIVIGFD TPEEADRVLL KLHSLKKEYL IDLEDAVVVV RDTDGKVHLK QSINLPTVGA        60
     ASGLLSGSLW GGLVGLLFLN PLAGFAIGGA IGAGAGALSG SLADYGIDDD FIKSLGSTIP       120
     NNSSALFILV RKVQPEKVLA ELSGLRGRVL KTSLSPEQEH KLQAALSDAQ TPSPPAGTF        179
//

If you have problems or comments...

PBIL Back to PBIL home page