(data stored in ACNUC7421 zone)

EMBL: CP001389.PE8

CP001389.PE8         Location/Qualifiers
FT   CDS             complement(7071..7715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00080"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23812"
FT                   /db_xref="GOA:C3MEI9"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI9"
FT                   /protein_id="ACP23812.1"
FT                   /translation="MRKLVDKTLVVASHNAGKIREIRDLIGPLGFEAKSAADLNFVEPD
FT                   ETGTTFEENATIKALASARASGLPALSDDSGLAIDALGGAPGVYTANWAERDDGSRDFA
FT                   MAMEKVERELSEKGATKPEERTARFVSVLCLAWPDGHVELFRGEVEGHVVWPPRGTSGF
FT                   GYDPVFQPTGYDTTFGEMSAEEKHGWKPGNSEALSHRARAFKLFAETCLGA"
     MRKLVDKTLV VASHNAGKIR EIRDLIGPLG FEAKSAADLN FVEPDETGTT FEENATIKAL        60
     ASARASGLPA LSDDSGLAID ALGGAPGVYT ANWAERDDGS RDFAMAMEKV ERELSEKGAT       120
     KPEERTARFV SVLCLAWPDG HVELFRGEVE GHVVWPPRGT SGFGYDPVFQ PTGYDTTFGE       180
     MSAEEKHGWK PGNSEALSHR ARAFKLFAET CLGA                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page