(data stored in ACNUC7421 zone)

EMBL: CP001389.PE80

CP001389.PE80        Location/Qualifiers
FT   CDS             complement(85072..85725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00800"
FT                   /product="predicted GTP-binding protein EngB-related"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23884"
FT                   /db_xref="GOA:C3MF47"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF47"
FT                   /protein_id="ACP23884.1"
FT                   /translation="MAETTTKDDKPLFGRPWIFIRGVPSMKFLPPEGPAEIAFAGRSNV
FT                   GKSSLINALVGHKGLARTSNTPGRTQELNYFVPDGYSGEADDLPPMALVDMPGYGYAQA
FT                   PKEQVDAWTKLVFDYLRGRSTLKRVYVLIDARHGIKKNDEEVLALLDKAAVSYQIVLTK
FT                   TDKIKAAGVPRLIAETLDKIKKRPAAYPEVLSTSSEKGAGIEDLRITIEQAVAR"
     MAETTTKDDK PLFGRPWIFI RGVPSMKFLP PEGPAEIAFA GRSNVGKSSL INALVGHKGL        60
     ARTSNTPGRT QELNYFVPDG YSGEADDLPP MALVDMPGYG YAQAPKEQVD AWTKLVFDYL       120
     RGRSTLKRVY VLIDARHGIK KNDEEVLALL DKAAVSYQIV LTKTDKIKAA GVPRLIAETL       180
     DKIKKRPAAY PEVLSTSSEK GAGIEDLRIT IEQAVAR                                217
//

If you have problems or comments...

PBIL Back to PBIL home page