(data stored in ACNUC7421 zone)

EMBL: CP001389.PE81

CP001389.PE81        Location/Qualifiers
FT   CDS             complement(85782..86714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00810"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23885"
FT                   /db_xref="GOA:C3MF48"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF48"
FT                   /protein_id="ACP23885.1"
FT                   /translation="MTDPSATSASFGANEKFGTLLVFGSAFFWSFGGAIARFLHISDSW
FT                   TIVFWRCLFAGLFLLAFMLVRDGPRGTVSLVRGMGWPGVAVGLCFTTASTSFIIAISYT
FT                   TIANVVLLGAGVPLFAALMSWVLFRERVSRFTWGAIAAVIFGVAIMVSESLNGSVSPVG
FT                   DALALLIPVVFALATVITRRYPHVRMTPATCFGCFAASAIAASQSSDLSVTPGELALLF
FT                   AFGAFNLGLGMALFVTGARLVPSALAALLGTAETVLAPVWVAIIHGEVPSGRTIVGGVF
FT                   IFLALLAYLFNEFRGQRNGPRRPVRTPTP"
     MTDPSATSAS FGANEKFGTL LVFGSAFFWS FGGAIARFLH ISDSWTIVFW RCLFAGLFLL        60
     AFMLVRDGPR GTVSLVRGMG WPGVAVGLCF TTASTSFIIA ISYTTIANVV LLGAGVPLFA       120
     ALMSWVLFRE RVSRFTWGAI AAVIFGVAIM VSESLNGSVS PVGDALALLI PVVFALATVI       180
     TRRYPHVRMT PATCFGCFAA SAIAASQSSD LSVTPGELAL LFAFGAFNLG LGMALFVTGA       240
     RLVPSALAAL LGTAETVLAP VWVAIIHGEV PSGRTIVGGV FIFLALLAYL FNEFRGQRNG       300
     PRRPVRTPTP                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page