(data stored in ACNUC7421 zone)

EMBL: CP001389.PE82

CP001389.PE82        Location/Qualifiers
FT   CDS             complement(86963..88741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00820"
FT                   /product="putative inner membrane protein translocase
FT                   component YidC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00820"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23886"
FT                   /db_xref="GOA:C3MF49"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF49"
FT                   /protein_id="ACP23886.1"
FT                   /translation="MMENNRNYFVAIALSVLILVAWQYFYVNPRMDKDRIAAEKAQQTQ
FT                   QVQPQQGGQQPAPGQALPGGAVPGESRDQAVAKSARVAIDTPALSGSINLTGARFDDLK
FT                   LKGYHETVDPKSPVITLFSPAETADGYFTEIGYIGNDASGSVPGPQTVWTLSGGEKLTP
FT                   ATPVTLTYTNDKGITFARTISIDENYMFQVVDSIKNDGSAPVSLSSYGRVTRFNKPTTP
FT                   SIYVLHEGFIGVAGGSLQEVGYSKIEENLPVEPGKTTGGWHGITDKYWAAAIVPPQETP
FT                   FDIRFSHFTDGRPRFQSDYKGDAVTVAPGQSAEVKNLVFAGAKEVQVVDTYTTAYAIPK
FT                   FEKLIDWGWFWFITQPMFKMMDFFFRLFGNFGVAILVTTIVVKLIFFPLANKQYASMAN
FT                   MKKVQPKMEELKKKFGDDRMGLQQAMMQLYKDEKINPLAGCWPILIQIPVFFALYKVIY
FT                   ITIEMRHAPFFGWIRDLSAPDPTTIVNLFGLLPFDGPAFLHLGIWPIIMGVTMFLQMRM
FT                   NPTPPDPTQAMLFTWMPLVFTFMLASFPAGLVIYWAWNNTLSITQQSIIMKRQGVKIEL
FT                   FDNLKGLFTKRPKPAE"
     MMENNRNYFV AIALSVLILV AWQYFYVNPR MDKDRIAAEK AQQTQQVQPQ QGGQQPAPGQ        60
     ALPGGAVPGE SRDQAVAKSA RVAIDTPALS GSINLTGARF DDLKLKGYHE TVDPKSPVIT       120
     LFSPAETADG YFTEIGYIGN DASGSVPGPQ TVWTLSGGEK LTPATPVTLT YTNDKGITFA       180
     RTISIDENYM FQVVDSIKND GSAPVSLSSY GRVTRFNKPT TPSIYVLHEG FIGVAGGSLQ       240
     EVGYSKIEEN LPVEPGKTTG GWHGITDKYW AAAIVPPQET PFDIRFSHFT DGRPRFQSDY       300
     KGDAVTVAPG QSAEVKNLVF AGAKEVQVVD TYTTAYAIPK FEKLIDWGWF WFITQPMFKM       360
     MDFFFRLFGN FGVAILVTTI VVKLIFFPLA NKQYASMANM KKVQPKMEEL KKKFGDDRMG       420
     LQQAMMQLYK DEKINPLAGC WPILIQIPVF FALYKVIYIT IEMRHAPFFG WIRDLSAPDP       480
     TTIVNLFGLL PFDGPAFLHL GIWPIIMGVT MFLQMRMNPT PPDPTQAMLF TWMPLVFTFM       540
     LASFPAGLVI YWAWNNTLSI TQQSIIMKRQ GVKIELFDNL KGLFTKRPKP AE               592
//

If you have problems or comments...

PBIL Back to PBIL home page