(data stored in ACNUC7421 zone)

EMBL: CP001389.PE85

CP001389.PE85        Location/Qualifiers
FT   CDS             89613..91610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00850"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23889"
FT                   /db_xref="GOA:C3MF52"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF52"
FT                   /protein_id="ACP23889.1"
FT                   /translation="MRIRGKIYLIVGIMSLLAVAITGMSLLIVSKYNDELGQFQNASER
FT                   SFKGERLNRLVTAVVMESRGVYAAPTIEKATPFAEGIIKNLGKIDALLKEWRPLVPADR
FT                   LPAFDAVAKRAEEFKAFRTETARLGREVSPQAANEQGNNEANRANRKAFQAEIDVVVDA
FT                   DRESLQAITDGIAAFERTVVLIVLGIAGLGMAAGIGTAFYIGTNHLSRPIVDLTGRMKL
FT                   LAGGDLSVDVPFAGRKDEIGDMAAAVEVFKQNGLAVRELNAQEAALREKSADLQSSIGI
FT                   VVAAAAAGDFAQRIGKDYDNDDLNRFAASVNELVGSVDSGIAETRRVIASLAAGDLTES
FT                   MDGSFQGAFAELQKNVNETFTTLQKTMREVRSATDSINGNASELRSAADDLSKRTEQQA
FT                   AALEETSAALDEITAAVRSSTERAHEATIMVTEAKENAAESASVVRNAIDAMGRIEQAS
FT                   SEIGQITNVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRAASAAKDI
FT                   KGLISKSGSEVATGVKLVQATGAALGEIETRVLKINDHIHSIATAAREQSTGLGEVSTA
FT                   VNQMDQVTQRNAAMVEEANAATHKLSAEANGLATLITYFKVDREPARTITPARETARPV
FT                   ASPARRMMGTVARAFGGGSAAAARSDWEEF"
     MRIRGKIYLI VGIMSLLAVA ITGMSLLIVS KYNDELGQFQ NASERSFKGE RLNRLVTAVV        60
     MESRGVYAAP TIEKATPFAE GIIKNLGKID ALLKEWRPLV PADRLPAFDA VAKRAEEFKA       120
     FRTETARLGR EVSPQAANEQ GNNEANRANR KAFQAEIDVV VDADRESLQA ITDGIAAFER       180
     TVVLIVLGIA GLGMAAGIGT AFYIGTNHLS RPIVDLTGRM KLLAGGDLSV DVPFAGRKDE       240
     IGDMAAAVEV FKQNGLAVRE LNAQEAALRE KSADLQSSIG IVVAAAAAGD FAQRIGKDYD       300
     NDDLNRFAAS VNELVGSVDS GIAETRRVIA SLAAGDLTES MDGSFQGAFA ELQKNVNETF       360
     TTLQKTMREV RSATDSINGN ASELRSAADD LSKRTEQQAA ALEETSAALD EITAAVRSST       420
     ERAHEATIMV TEAKENAAES ASVVRNAIDA MGRIEQASSE IGQITNVIDE IAFQTNLLAL       480
     NAGVEAARAG DAGKGFAVVA QEVRELAQRA ASAAKDIKGL ISKSGSEVAT GVKLVQATGA       540
     ALGEIETRVL KINDHIHSIA TAAREQSTGL GEVSTAVNQM DQVTQRNAAM VEEANAATHK       600
     LSAEANGLAT LITYFKVDRE PARTITPARE TARPVASPAR RMMGTVARAF GGGSAAAARS       660
     DWEEF                                                                   665
//

If you have problems or comments...

PBIL Back to PBIL home page