(data stored in ACNUC7421 zone)

EMBL: CP001389.PE86

CP001389.PE86        Location/Qualifiers
FT   CDS             91805..92602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00860"
FT                   /product="hypothetical protein contains SNARE associated
FT                   Golgi protein region"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00860"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23890"
FT                   /db_xref="GOA:C3MF53"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF53"
FT                   /protein_id="ACP23890.1"
FT                   /translation="MSHGVSNGAEEKTALRARPGRDERVSGGGRSLWRAVPLALLIAGG
FT                   LAFYALGLQHHVSLSALVRHQEALSLHVDAFPVRSVLVFFFAYVAAVVFSIPAASVLTM
FT                   SAGFLFGPFLGGTITVLAATLGSSLLFLAARGVLSDLLRRRAGRFLERLAEGFRRNAFL
FT                   YLLILRLAPIFPFFIVNIAPAFFDVKLRTFVAATLIGIVPATFAYAWLGCGLDDVIERA
FT                   GESGHALALSDFATKEISLALLALALFAALPLAYRLLQSRRQG"
     MSHGVSNGAE EKTALRARPG RDERVSGGGR SLWRAVPLAL LIAGGLAFYA LGLQHHVSLS        60
     ALVRHQEALS LHVDAFPVRS VLVFFFAYVA AVVFSIPAAS VLTMSAGFLF GPFLGGTITV       120
     LAATLGSSLL FLAARGVLSD LLRRRAGRFL ERLAEGFRRN AFLYLLILRL APIFPFFIVN       180
     IAPAFFDVKL RTFVAATLIG IVPATFAYAW LGCGLDDVIE RAGESGHALA LSDFATKEIS       240
     LALLALALFA ALPLAYRLLQ SRRQG                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page