(data stored in ACNUC7421 zone)

EMBL: CP001389.PE90

CP001389.PE90        Location/Qualifiers
FT   CDS             complement(96498..97679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23894"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF57"
FT                   /protein_id="ACP23894.1"
FT                   /translation="MTRIHMRRLAVARTGAVLLAFPVAAMAEDRLPILAEDCTAPCAGY
FT                   EVTAELQNDWVFAADPSLLKSDELEPTITVDLFLAPTDNLRFVASIITEQVVEPEAGEN
FT                   AVFQGIGTYLAELYTAVATGPATIRAGKFDTIFSLASEVAPGINATELVSDIDADERLG
FT                   AEVVLDFGGLGMEQVLAATAFTTDRSVLGNSLFTRRGRTRLSDGGAGNTDGLSSFSMTL
FT                   DGCRGSEPIDCYLEGDFGYRLGIRYQAAGAQSGEDTEDSPGDEVGYLAAATTSLELDEM
FT                   TLRLLGETAYLRHFDGGSDDALLLTGSAALELEPVTYVASYTQQLNLVAGEPDRREHLA
FT                   DFEAIYEPREGTSLEGWEFAAAYTVARDADETAHIFSVRAVFNFDGDAELGSR"
     MTRIHMRRLA VARTGAVLLA FPVAAMAEDR LPILAEDCTA PCAGYEVTAE LQNDWVFAAD        60
     PSLLKSDELE PTITVDLFLA PTDNLRFVAS IITEQVVEPE AGENAVFQGI GTYLAELYTA       120
     VATGPATIRA GKFDTIFSLA SEVAPGINAT ELVSDIDADE RLGAEVVLDF GGLGMEQVLA       180
     ATAFTTDRSV LGNSLFTRRG RTRLSDGGAG NTDGLSSFSM TLDGCRGSEP IDCYLEGDFG       240
     YRLGIRYQAA GAQSGEDTED SPGDEVGYLA AATTSLELDE MTLRLLGETA YLRHFDGGSD       300
     DALLLTGSAA LELEPVTYVA SYTQQLNLVA GEPDRREHLA DFEAIYEPRE GTSLEGWEFA       360
     AAYTVARDAD ETAHIFSVRA VFNFDGDAEL GSR                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page