(data stored in ACNUC7421 zone)

EMBL: CP001389.PE91

CP001389.PE91        Location/Qualifiers
FT   CDS             98110..99852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23895"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF58"
FT                   /protein_id="ACP23895.1"
FT                   /translation="MPNFAAATFNPGAPINNPYLPLIPGHVLSYMGDETDPDTGEVTTE
FT                   RNDVFTTSASFEVRGVATTVIRDTVYEDDVIIEDTFDWYAQDTAGNVWYFGEIVVNYEY
FT                   DDDGNFVGVNHDGQWSADDPGNQPGWAMKASPEFGPAYYLEFAPGIAEDESILAETGLS
FT                   VKTSFGQFEDVIKIIDSSALSTGVEFKYYAPGVGEITETAVAPDGTATSQVDLYRNGIV
FT                   GQVDADDSDDVTPALAKLKESKTVEDLAEIRDLEMADFAGIGTTKQVTVIGGSTDSADA
FT                   LGAYFIDEATGAISEGRILVADLSDAASGTSIAVDVPDGQSLCLFLVRGTDEIGVDLEQ
FT                   FADGGMQLKNLLTGAPANVNDPFAPTVMDDAGNILPIQPLSALGADDGGNLLNPAGSMQ
FT                   AIGLSSSAAGASGIEIIGFEDRLNTSPDYDGDFNDAILAVSDAPIPAETLQQLVREAGG
FT                   GKTASSGIAQSSNEPAGEVPDGEQAEEADDSGTGESLEDTLDEWLTGDTFVFADGAHRV
FT                   GRVADLELDRWDGFLVDGDWVDFSHLERLCNDHPDGIGAHFDGVPDGVLKAGAALSADG
FT                   FFIA"
     MPNFAAATFN PGAPINNPYL PLIPGHVLSY MGDETDPDTG EVTTERNDVF TTSASFEVRG        60
     VATTVIRDTV YEDDVIIEDT FDWYAQDTAG NVWYFGEIVV NYEYDDDGNF VGVNHDGQWS       120
     ADDPGNQPGW AMKASPEFGP AYYLEFAPGI AEDESILAET GLSVKTSFGQ FEDVIKIIDS       180
     SALSTGVEFK YYAPGVGEIT ETAVAPDGTA TSQVDLYRNG IVGQVDADDS DDVTPALAKL       240
     KESKTVEDLA EIRDLEMADF AGIGTTKQVT VIGGSTDSAD ALGAYFIDEA TGAISEGRIL       300
     VADLSDAASG TSIAVDVPDG QSLCLFLVRG TDEIGVDLEQ FADGGMQLKN LLTGAPANVN       360
     DPFAPTVMDD AGNILPIQPL SALGADDGGN LLNPAGSMQA IGLSSSAAGA SGIEIIGFED       420
     RLNTSPDYDG DFNDAILAVS DAPIPAETLQ QLVREAGGGK TASSGIAQSS NEPAGEVPDG       480
     EQAEEADDSG TGESLEDTLD EWLTGDTFVF ADGAHRVGRV ADLELDRWDG FLVDGDWVDF       540
     SHLERLCNDH PDGIGAHFDG VPDGVLKAGA ALSADGFFIA                             580
//

If you have problems or comments...

PBIL Back to PBIL home page