(data stored in ACNUC7421 zone)

EMBL: CP001389.PE92

CP001389.PE92        Location/Qualifiers
FT   CDS             99902..100561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00930"
FT                   /product="hypothetical protein associated with LuxR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00930"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23896"
FT                   /db_xref="GOA:C3MF59"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF59"
FT                   /protein_id="ACP23896.1"
FT                   /translation="MAAVLRVAGRRRQRRWAMDWTKGRGRQILIFGAVGTFALLLGLEV
FT                   VKEEEEWTVAELLTEAVSIALLVGCSACVALLSSRLREQEADNLDLRDKVARIRESNAQ
FT                   WRADLADHFQELGAAIQRQFGAWGCTQAEQEVGLLLLKGFSHKEIARIRGASEATIRQQ
FT                   ATSVYHKAELSGRAALSAYFLEELLLPPVPTAQTSARGDGVARPENAEVSGRIVPG"
     MAAVLRVAGR RRQRRWAMDW TKGRGRQILI FGAVGTFALL LGLEVVKEEE EWTVAELLTE        60
     AVSIALLVGC SACVALLSSR LREQEADNLD LRDKVARIRE SNAQWRADLA DHFQELGAAI       120
     QRQFGAWGCT QAEQEVGLLL LKGFSHKEIA RIRGASEATI RQQATSVYHK AELSGRAALS       180
     AYFLEELLLP PVPTAQTSAR GDGVARPENA EVSGRIVPG                              219
//

If you have problems or comments...

PBIL Back to PBIL home page