(data stored in ACNUC7421 zone)

EMBL: CP001389.PE96

CP001389.PE96        Location/Qualifiers
FT   CDS             complement(103136..103915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23900"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF63"
FT                   /protein_id="ACP23900.1"
FT                   /translation="MPHTLHSLLTDATRPKFSGRALGRNGRQSPSHLWGGAMLRLGKQS
FT                   IEDDEAPPFRYQRCQTGKQRMFTLQRIETSAQEIRKSRFVAIAGSIDDEQAAKAFLAAH
FT                   SEPAANHNCWAWRIGQTYRFNDDGEPSGTAGKPILAAIDGQSLDRVVVVVTRWFGGVLL
FT                   GSGGLIRAYGGTAALCLRAAEKVERVETHRATVACDFADLALIKARLTARGIAIASESF
FT                   TDTGAMLVIDFRKDAAEATLTLVSDLSRGRAIVSLDT"
     MPHTLHSLLT DATRPKFSGR ALGRNGRQSP SHLWGGAMLR LGKQSIEDDE APPFRYQRCQ        60
     TGKQRMFTLQ RIETSAQEIR KSRFVAIAGS IDDEQAAKAF LAAHSEPAAN HNCWAWRIGQ       120
     TYRFNDDGEP SGTAGKPILA AIDGQSLDRV VVVVTRWFGG VLLGSGGLIR AYGGTAALCL       180
     RAAEKVERVE THRATVACDF ADLALIKARL TARGIAIASE SFTDTGAMLV IDFRKDAAEA       240
     TLTLVSDLSR GRAIVSLDT                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page